Se rendre au contenu

ELISA Recombinant Arabidopsis thaliana ATP synthase subunit a-1(ATP6-1)

https://www.transgenicnews.com/web/image/product.template/116517/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:P93298 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SPLDQFEIVPLIPMHIGNFYFSFTNSSLFmLLTLSFFLLLIHFVTKKGGGNLVPNAWQSL VELLYDFVLNLVKEQIGGLSGNVKQMFFPCILVTFLFLLFCNLQGMIPYSFTVTSHFLIT LALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRALSLGIRLF ANMMAGHSLVKILSGFAWTmLCMNDIFYFIGALGPLFIVLALTGLELGVAILQAYVFTIL ICIYLNDAINLH Protein Names:Recommended name: ATP synthase subunit a-1 Alternative name(s): F-ATPase protein 6 P6-1 Gene Names:Name:ATP6-1 Ordered Locus Names:AtMg00410 Expression Region:134-385 Sequence Info:fµLl length protein

1.601,00 € 1601.0 EUR 1.601,00 €

1.601,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables