ELISA Recombinant Saccharomyces cerevisiae Protein ILM1(ILM1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P47155 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAQALNSTNIAFFRVAFLFTIAFFCLKNVNSILQNTYFIVLTQAMNLPQLTLSRYSGQLG LFALLFTLNGVHDLIPLLENNVKYFQSVVPVRLLIFFILTSISYLWESNFYVHNNSVFIY CFAEVWINFLLYNAIREEKNEEFKRLNQFMVNDEDIEEPQPFTVKTETTEIIEIINDEEN DDEDGKDNDDNNEKGNDDSDAKK Protein Names:Recommended name: Protein ILM1 Alternative name(s): Increased loss of mitochondrial DNA protein 1 Gene Names:Name:ILM1 Ordered Locus Names:YJR118C ORF Names:J2033 Expression Region:1-203 Sequence Info:fµLl length protein