Skip to Content

ELISA Recombinant Haemophilus influenzae UPF0756 membrane protein CGSHiGG_08995 (CGSHiGG_08995)

https://www.transgenicnews.com/web/image/product.template/128503/image_1920?unique=45d657d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Haemophilus influenzae (strain PittGG) Uniprot NO.:A5UIJ7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTLQLNTIALLLVILLILGVLSNNSAITISAAVLLIMQQTFLSSHIPLLEKYGVKIGIII LTIGVLSPLVSGKIQLPDLSGFLSWKMALSISVGVLVAWLAGKGVPLMGEQPILVTGLLI GTIIGVAFLGGIPVGPLIAAGILALLLGKI Protein Names:Recommended name: UPF0756 membrane protein CGSHiGG_08995 Gene Names:Ordered Locus Names:CGSHiGG_08995 Expression Region:1-150 Sequence Info:fµLl length protein

1,493.00 € 1493.0 EUR 1,493.00 €

1,493.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days